PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000157.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 338aa    MW: 38234.2 Da    PI: 8.4475
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000157.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.81.1e-49772081128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL kkv+++  +++++i+e+diyk++Pw+Lp + + +ekew+fFs+rd+ky++g+r+nra++sgyWkat
  Itr_sc000157.1_g00004.1  77 LPPGFRFHPTDEELITCYLMKKVASSADPTASMIAEADIYKFNPWELPGRGYFGEKEWFFFSPRDRKYPNGHRPNRAAASGYWKAT 162
                              79*************************999999***************8778899******************************* PP

                      NAM  87 gkdkevlsk....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk++ls+    +++ +g+kk Lvfy+gr +kg ktdW+m eyrl
  Itr_sc000157.1_g00004.1 163 GTDKPILSAttasSSRCIGVKKALVFYRGRPQKGIKTDWTMCEYRL 208
                              ********876666666***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-5972236IPR003441NAC domain
PROSITE profilePS5100557.56877236IPR003441NAC domain
PfamPF023651.9E-2578208IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MEGNQYANFL ANLRRVSSLG TMNIDEPPDD LKDLLDRPPG NKACRLGGLP IKPSLPQWEI  60
KGQDTLYFIM QDMTQSLPPG FRFHPTDEEL ITCYLMKKVA SSADPTASMI AEADIYKFNP  120
WELPGRGYFG EKEWFFFSPR DRKYPNGHRP NRAAASGYWK ATGTDKPILS ATTASSSRCI  180
GVKKALVFYR GRPQKGIKTD WTMCEYRLLN NAHQQAFRQK GSMRLDDWVL CRVRNKSNNI  240
AEGRFGNGKE DITEKINPSY DHHCYAGGSQ VLNGLEYFGH FQFQTGSSSN HSNPQTNIMG  300
GSVKEALENI KRVLLFEPCM YGQPQILNQD EPELNPTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-647623814170Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027935.14e-82PREDICTED: protein FEZ-like
SwissprotA2YMR07e-71NAC10_ORYSI; NAC transcription factor ONAC010
TrEMBLA0A068TT873e-92A0A068TT87_COFCA; Uncharacterized protein
STRINGPOPTR_0004s04920.12e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1742534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.22e-70NAC domain containing protein 47